PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_2190_f_3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family SBP
Protein Properties Length: 239aa    MW: 26520.6 Da    PI: 8.2038
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_2190_f_3genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP78.21.3e-24181229250
                    -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEE CS
            SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfh 50 
                    Cqv gC++dls+ k+yh+rhkvCevhsk+p+v+v+g eqrfCqqCsrf 
  Neem_2190_f_3 181 CQVYGCNKDLSSSKDYHKRHKVCEVHSKTPKVIVNGNEQRFCQQCSRFC 229
                    ************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.105.8E-25175228IPR004333Transcription factor, SBP-box
PROSITE profilePS5114120.615178239IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.66E-23179229IPR004333Transcription factor, SBP-box
PfamPF031101.5E-18181228IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MESWSYGSEG KGFLFSDEVD LPVDSFSRSR KALMGWESKP SYNFDINKLI SDNDAAENMK  60
FMDPGFTDLT RKPCHSNTTM GTLNGDVGSD SNKRIITPSC LLTSNSFCGE EESRSKISNS  120
CTESISQDST QIDLNLGRLV DSRNVQSDKF LKERSVASSA RPSLAAKKAR TTSSCSQTPL  180
CQVYGCNKDL SSSKDYHKRH KVCEVHSKTP KVIVNGNEQR FCQQCSRFCT NNSVKVANQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj0_A6e-16181228653squamosa promoter-binding protein-like 12
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006437881.11e-125hypothetical protein CICLE_v10031270mg
RefseqXP_006437880.11e-125hypothetical protein CICLE_v10031270mg
RefseqXP_015387352.11e-125PREDICTED: squamosa promoter-binding-like protein 6 isoform X4
TrEMBLV4THN21e-125V4THN2_9R
TrEMBLV4TMS61e-125V4TMS6_9R
STRINGPOPTR_0008s09750.16e-77(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM14770918
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.14e-35SBP family protein